PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G313600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WRKY
Protein Properties Length: 311aa    MW: 32191.9 Da    PI: 9.1002
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G313600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.27.3e-33129186259
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers++dp+vv++tYeg+H h+
  Brast02G313600.1.p 129 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSSDDPSVVITTYEGQHCHH 186
                         8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-33113187IPR003657WRKY domain
SuperFamilySSF1182901.44E-28120187IPR003657WRKY domain
PROSITE profilePS5081129.964123188IPR003657WRKY domain
SMARTSM007748.6E-39128187IPR003657WRKY domain
PfamPF031064.3E-26129186IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MAGAAGDRPE GVGWSLAGDG FAEYSSALFA ELGGWPGGAA AAELPALDLP PAPRAAAAAV  60
PWSEEITTPA GPAGGPADAA GGASSSSSGA AAEAASMKPA AAATTKKGQK RARQARFAFM  120
TKSEIDHLED GYRWRKYGQK AVKNSPFPRS YYRCTNSKCT VKKRVERSSD DPSVVITTYE  180
GQHCHHTASL QRGFGAGATP AMHFHGAAAA VALAEQMSFV SAQQQQLYNQ LPSAPLRLRQ  240
MNVRLPSSES PETGVSSTEA AASVQQLDRS NELRSPTAAM ARSPSSSVPP SVTFDRGLLG  300
DIVPPGVRHG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-26119185874Probable WRKY transcription factor 4
2lex_A3e-26119185874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3702991e-108AK370299.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2108G21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229639.11e-142PREDICTED: probable WRKY transcription factor 48
RefseqXP_003559239.11e-142PREDICTED: probable WRKY transcription factor 48
RefseqXP_010229633.11e-142PREDICTED: probable WRKY transcription factor 48
TrEMBLI1GN431e-142I1GN43_BRADI; Uncharacterized protein
STRINGBRADI1G08106.11e-142(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.21e-52WRKY DNA-binding protein 57